Why is it that I have intellisense enabled for .js files but not for .ts files?

Below is the content of my package.json:

 {
    "name": "edge-node-api",
    "version": "1.0.0",
    "description": "Web API for Edge Electrons customers",
    "main": "api.js",
    "scripts": {
    "test": "echo \"Error: no test specified\" && exit 1"
 },
"repository": {
    "type": "git",
    "url": "http://192.168.0.50:3000/lem/edge-node-api.git"
},
"author": "lem",
"license": "ISC",
"dependencies": {
    "body-parser": "^1.17.2",
    "bull": "^3.0.0-alpha.4",
    "del": "^2.2.2",
    "express": "^4.15.3",
    "fm-log": "^4.4.3",
    "lodash": "^4.17.4",
    "memcached": "^2.2.2",
    "moment": "^2.18.1",
    "morgan": "^1.8.2",
    "njwt": "^0.4.0",
    "pg": "^6.2.2",
    "redis": "^2.7.1",
    "vali-date": "^1.0.0"
},
"devDependencies": {
    "@types/bull": "^2.1.0",
    "@types/node": "^7.0.22",
    "api-doc": "^4.0.0",
    "gulp": "^3.9.1",
    "gulp-develop-server": "^0.5.2",
    "gulp-sequence": "^0.4.6",
    "gulp-typescript": "^3.1.7",
    "typescript": "^2.3.3",
    "typings": "^2.1.1"
}

}

Here is the configuration from my tsconfig.json file:

{
    "compilerOptions": {
        "module": "commonjs",
        "target": "es2017",
        "sourceMap": true,
        "removeComments": true,
        "outDir": "dist"
    },
    "include": [
        "src/**/*.ts"
    ],
    "exclude": [
        "node_modules"
    ]
}

Lastly, here are the typings listed in my typings.json file:

{
    "devDependencies": {
        "body-parser": "registry:npm/body-
            parser#1.15.2+20161116154925",
        "debug": "registry:npm/debug#2.0.0+20170504163145",
        "express": "registry:npm/express#4.14.0+20170217205433",
        "gulp": "registry:npm/gulp#4.0.0-alpha.2+20160817105618",
        "lodash": "registry:npm/lodash#4.0.0+20161015015725",
        "memcached": "registry:dt/memcached#2.2.0+20170324151803",
        "morgan": "registry:dt/morgan#1.7.0+20160726064905",
        "pg": "registry:npm/pg#6.0.2+20170314174547",
        "redis": "registry:npm/redis#2.6.0+20160901110043"
  },
  "dependencies": {},
  "globalDevDependencies": {
      "bull": "registry:dt/bull#2.1.2+20170221033156"
  }

Do you notice anything missing?

typescripttypescript-typingstypescript2.0

Answer №1

After removing the following snippet:

"include": [ "src/**/*.ts" ],

from my tsconfig.json file, everything started working perfectly.

Similar questions

If you have not found the answer to your question or you are interested in this topic, then look at other similar questions below or use the search

"Observables in RxJs: Climbing the Stairs of

Previously, I utilized Promise with async/await syntax in my Typescript code like this: const fooData = await AsyncFooData(); const barData = await AsyncBarData(); ... perform actions using fooData and barData However, when using RxJs Observable<T> ...

typescriptrxjs

Enhancing the efficiency of Angular applications

My angular application is currently coded in a single app.module.ts file, containing all the components. However, I am facing issues with slow loading times. Is there a way to improve the load time of the application while keeping all the components within ...

angulartypescriptlazy-loadingangular-module

What is the best way to modify the disabled attribute?

After disabling a button using a boolean variable, updating the variable does not remove the disabled attribute. How can I update my code to enable the button when the variable changes? Here is my current code snippet: var isDisabled = true; return ( ...

reactjstypescriptnext.js

Steps to create a personalized loading screen using Angular

I am looking to enhance the loading screen for our angular 9 application. Currently, we are utilizing <div [ngClass]="isLoading ? 'loading' : ''> in each component along with the isloading: boolean variable. Whenever an API ...

angulartypescript

Ways to create a fixed button positioned statically at the bottom of a page

Currently, I am utilizing tailwind CSS to create a webpage with Next and Back buttons for navigation. However, an issue arises when there is minimal content on the page as the button adheres to the top. For visual reference, please view the image linked be ...

javascripthtmlcsstypescripttailwind-css

Conditional generic type in return type with Typescript

How can I condition the generic return type when a value is not present? type Foo = {}; class Bar<P extends Foo> { static make<P extends Foo>(a?: P): Bar<P> { return new Bar(); } } Bar.make() // returns Bar<Foo> ...

typescripttypescript-generics

Guide on properly specifying mapDispatchToProps in a component's props interface

In my project, I have a connected component utilizing mapStateToProps and mapDispatchToProps along with the connect HOC from react-redux. My goal is to create concise and future-proof type definitions for this component. When it comes to defining types fo ...

reactjstypescriptreduxreact-redux

What is the reason for IE displaying null when the model does not exist?

Why does IE 11 render 'null' if my model does not exist? For instance: <tr> <td [innerHTML]="model?.prop1 | my-pipe"></td> </tr> Imagine this scenario: When the page loads, a request is sent to the server and the res ...

javascriptangulartypescript

Angular: efficient exchange of information among components

I have a component X that handles a WebSocket. And within component X, I also have multiple presentation components (e.g. Y). Whenever the WebSocket receives a specific message, I need to perform an action in a particular component (e.g. refresh data). To ...

angulartypescriptrxjs

Experience the dynamic synergy of React and typescript combined, harnessing

I am currently utilizing ReactJS with TypeScript. I have been attempting to incorporate a CDN script inside one of my components. Both index.html and .tsx component // .tsx file const handleScript = () => { // There seems to be an issue as the pr ...

javascriptreactjstypescript

Guide on Linking a Variable to $scope in Angular 2

Struggling to find up-to-date Angular 2 syntax is a challenge. So, how can we properly connect variables (whether simple or objects) in Angular now that the concept of controller $scope has evolved? import {Component} from '@angular/core' @Comp ...

javascriptangulartypescript

Is it possible to pass multiple parameters in Angular by utilizing the click() function?

Is there a method for passing parameters with click() in Angular? <a asp-action="CreateSales" (click)="CreateSales(productname='pa', price='16.5')">Some Text</a> I am still learning Angular and would appreciat ...

angulartypescript

Combining two observables into one and returning it may cause Angular guards to malfunction

There are two important services in my Angular 11 project. One is the admin service, which checks if a user is an admin, and the other is a service responsible for fetching CVs to determine if a user has already created one. The main goal is to restrict ac ...

javascriptangulartypescriptrxjs

Importing configuration file in CRA Typescript with values for post-deployment modifications

I am currently working on a React app that utilizes Create React App and Typescript. My goal is to read in configuration values, such as API URLs. I have a config.json file containing this data, here's a sample snippet with placeholder information: { ...

reactjstypescript

Higher order components enhance generic components

I'm facing an issue where I want to assign a generic type to my React component props, but the type information gets lost when I wrap it in a higher order component (material-ui). How can I ensure that the required information is passed along? type P ...

reactjstypescriptmaterial-ui

Implementing a boolean toggle method in Typescript for a class property

Hello there, fellow programmers! I am interested in changing the value of a class field using a method. I have a button in Angular that, when clicked, triggers the onSave() method: export class CourseComponent { isActive:boolean; onSave() { ...

angulartypescript

Running the nestjs build command is impossible without the existence of the node_modules folder

Currently, I am in the process of creating a Nestjs micro-service and everything is going smoothly. To run the build found within the dist folder, I use the command below: node dist/main.js However, I encountered a problem where this command does not exec ...

node.jstypescriptnestjs

Custom-designed foundation UI element with a parameter triggers TypeScript issue

When running this tsx code: import React from "react"; import BaseButton from "@mui/base/Button"; import styled from "@emotion/styled"; export const enum BUTTON_TYPE { MAIN = "main", LINK = "link", } ...

reactjstypescriptmaterial-uibase-ui

How to correct placeholder text display in the input of a Material UI text field

Currently, I am utilizing the material ui text field component. The issue at hand is that when the text field is in focus, the placeholder shifts to the top of the field. https://i.stack.imgur.com/P5flf.png I prefer for the placeholder to remain within ...

reactjstypescriptmaterial-uitextfield

"Exploring the relationship between Typescript and Angular: transforming variables within different

Ever since I made the switch from JavaScript to TypeScript (Version 2.1.5), I have been facing an issue with the code that filters date selection. Despite my efforts, I haven't been able to find a good fix for it yet. Here are the two date-pickers: F ...

javascriptangularjstypescriptangular-material